redox status comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-06-08. Numbers and descriptions here follow the published literature rather than marketing material.
Measuring glutathione requires attention to oxidation during sample handling, because GSH in biological samples can convert to GSSG or form mixed disulfides with proteins after collection. Acidic extraction, rapid cooling, and chelating agents are commonly used to limit such changes. Analytical methods usually distinguish free reduced glutathione, total glutathione, and protein-bound forms. Because these forms have different stability and reactivity, reported values depend heavily on the preparation protocol. No single preparation is universally suitable for every biological matrix or analytical goal.
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
Glutathione is a small tripeptide built from glutamic acid, cysteine, and glycine. Its peptide bond between glutamate and cysteine involves the gamma-carboxyl group rather than the usual alpha-carboxyl group. This structure gives the molecule a reactive thiol on the cysteine residue. The reduced form, often abbreviated GSH, is the predominant intracellular species in many cell types. Because the thiol can donate electrons, glutathione participates in redox chemistry and in the conjugation of reactive molecules.
Cells synthesize glutathione through two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine, and glutathione synthetase adds glycine to form the complete tripeptide. Breakdown occurs through gamma-glutamyl transpeptidase and subsequent peptidase reactions, forming the gamma-glutamyl cycle. Within cells, glutathione also forms a disulfide-linked dimer called GSSG when two GSH molecules react. The balance between GSH and GSSG is widely used as an indicator of oxidative conditions, although the ratio can vary by compartment and tissue.
| Property | Value | Notes |
|---|---|---|
| Reduced form | GSH | Main intracellular thiol |
| Oxidized form | GSSG | Disulfide dimer of two GSH molecules |
| Common separation method | Reversed-phase HPLC | Often with ion-pairing or derivatization |
| Typical detection | Fluorescence or mass spectrometry | UV detection is also used in some assays |
| Storage of standards | -20 °C or below, desiccated | Limit freeze-thaw and moisture exposure |
Glutathione is synthesized in two ATP-dependent steps. First, gamma-glutamylcysteine synthetase links glutamate and cysteine; second, glutathione synthetase adds glycine to form the complete tripeptide. The pathway is feedback-inhibited by GSH itself, which helps maintain steady intracellular levels. Tissues vary widely in glutathione content, with the liver typically containing the highest concentrations, followed by the kidneys, lungs, and erythrocytes. Because cysteine is often limiting, its availability influences synthesis rates, and regulation of this pathway varies by cell type.
Glutathione serves as a cofactor for several enzymes, including glutathione peroxidase and glutathione S-transferase. These enzymes help reduce hydrogen peroxide and lipid peroxides, and they conjugate reactive electrophiles for excretion. The molecule also acts as a reservoir for cysteine, an amino acid that is prone to oxidation. In addition, glutathione participates in the metabolism of nitric oxide, leukotrienes, and prostaglandins. Its roles extend to cell signaling, apoptosis, and the regulation of protein function through S-glutathionylation.
Interpreting glutathione measurements requires attention to pre-analytical variables. The GSSG concentration in a sample can rise artificially during storage or processing, making the GSH/GSSG ratio unreliable if not controlled. Reference ranges vary by specimen type, assay, and population, so comparisons across studies are difficult. Plasma glutathione is low and sensitive to hemolysis, while whole blood reflects primarily erythrocyte content. Many studies measure total glutathione rather than the reduced and oxidized forms separately, which limits conclusions about redox status.
Accurate measurement of glutathione begins with careful sample handling. Because GSH oxidizes rapidly to GSSG, samples must be processed quickly or frozen immediately. Acid precipitation with metaphosphoric acid or perchloric acid is common; it lowers pH, precipitates proteins, and helps preserve the reduced form. Chelating agents such as EDTA can limit metal-catalyzed oxidation. For whole blood, hemolysis releases glutathione from erythrocytes, so plasma and serum values differ substantially from whole blood values.
Several analytical methods can quantify glutathione, including high-performance liquid chromatography (HPLC) with UV or fluorescence detection for separating GSH and GSSG. Liquid chromatography-tandem mass spectrometry (LC-MS/MS) offers higher specificity and sensitivity, often detecting nanomolar concentrations. The enzymatic recycling assay, often called the Tietze method, measures total glutathione by coupling reduction of GSSG to a colorimetric or fluorometric readout. Capillary electrophoresis and electrochemical detection are also used in specialized laboratories. Each method has distinct advantages and limitations regarding throughput, cost, and susceptibility to interference.
Profilin is an actin-binding protein involved in the dynamic turnover and reconstruction of the actin cytoskeleton. It is found in most eukaryotic organisms. Profilin is important for spatially and temporally controlled growth of actin microfilaments, which is an essential process in cellular locomotion and cell shape changes. This restructuring of the actin cytoskeleton is essential for processes such as organ development, wound healing, and the hunting down of infectious intruders by cells of the immune system. Profilin also binds sequences rich in the amino acid proline in diverse proteins. While most profilin in the cell is bound to actin, profilins have over 50 different binding partners. Many of those are related to actin regulation, but profilin also seems to be involved in activities in the nucleus such as mRNA splicing. Profilin is the major allergen (via IgE) present in birch, grass, and other pollen.
Klibanski became chief of the Neuroendocrine Unit at Massachusetts General Hospital, studying hormones and neuroendocrinology with a focus on hypopituitarism and pituitary tumors. Her clinical research has also examined the effects of hypothalamic and pituitary disorders on body composition and bone density, including bone loss associated with anorexia nervosa and growth hormone deficiency. In 1997, Klibanski became the first woman from Mass General's Department of Medicine to become a professor of medicine at Harvard. She has authored more than 350 peer-reviewed papers and book chapters and has received the Endocrine Society Clinical Investigator Award and the Clinical Endocrinology Trust Medal from the Society for Endocrinology. Klibanski has served on the National Institute of Diabetes and Digestive and Kidney Diseases Board of Counselors and the editorial board of the Journal of Clinical Endocrinology and Metabolism, and is a past president of the Pituitary Society. She established the Center for Faculty Development at Massachusetts General Hospital and mentored more than fifty women, for which she received the Endocrine Society's Outstanding Mentor Award.
The transduction of the signal through the membrane by the receptor is not completely understood. It is known that in the inactive state, the GPCR is bound to a heterotrimeric G protein complex. Binding of an agonist to the GPCR results in a conformational change in the receptor that is transmitted to the bound Gα subunit of the heterotrimeric G protein via protein domain dynamics. The activated Gα subunit exchanges GTP in place of GDP which in turn triggers the dissociation of Gα subunit from the Gβγ dimer and from the receptor. The dissociated Gα and Gβγ subunits interact with other intracellular proteins to continue the signal transduction cascade while the freed GPCR is able to rebind to another heterotrimeric G protein to form a new complex that is ready to initiate another round of signal transduction. It is believed that a receptor molecule exists in a conformational equilibrium between active and inactive biophysical states. The binding of ligands to the receptor may shift the equilibrium toward the active receptor states. Three types of ligands exist: Agonists are ligands that shift the equilibrium in favour of active states; inverse agonists are ligands that shift the equilibrium in favour of inactive states; and neutral antagonists are ligands that do not affect the equilibrium. It is not yet known how exactly the active and inactive states differ from each other.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Ectopic fat is the storage of triglycerides in tissues other than adipose tissue, that are supposed to contain only small amounts of fat, such as the liver, skeletal muscle, heart, and pancreas. This can interfere with cellular functions and hence organ function and is associated with insulin resistance in type 2 diabetes. It is stored in relatively high amounts around the organs of the abdominal cavity, but is not to be confused with visceral fat. The specific cause for the accumulation of ectopic fat is unknown. The cause is likely a combination of genetic, environmental, and behavioral factors that are involved in excess energy intake and decreased physical activity. Substantial weight loss can reduce ectopic fat stores in all organs and this is associated with an improvement of the function of those organs. In the latter case, non-invasive weight loss interventions like diet or exercise can decrease ectopic fat (particularly in heart and liver) in overweight or obese children and adults.
ISOLDE contains both temporary and fixed experimental setups. Temporary setups in the ISOLDE facility are there for shorter time periods, and generally focus on detecting specific decay modes of nuclei. The fixed experimental setups have a permanent position at the facility. They include: The COLinear LAser SPectroScopy (COLLAPS) experiment has been operating at ISOLDE since the late 1970s and is the oldest active experiment at the facility. COLLAPS studies ground and isomeric state properties of highly-unstable (exotic), short-lived nuclei, including measurements of their spins, electro-magnetic moments and charge radii. The experiment uses the technique of collinear spectroscopy using lasers to access necessary atomic transitions. The Collinear Resonance Ionization Spectroscopy (CRIS) experiment uses fast beam collinear laser spectroscopy alongside the technique of resonance ionization to produce results with a high resolution and efficiency. The experiment studies group-state properties of exotic nuclei and produces isomeric beams used for decay studies.
Hydrogel from wood-based nanofibrillated cellulose (NFC) is used as a matrix for 3D cell culture, providing a three-dimensional environment that more closely resembles the conditions found in living tissue. As plant based material, it does not contain any human- or animal-derived components. Nanocellulose is instead derived from wood pulp that has been processed to create extremely small, nanoscale fibers. These fibers can be used to create a hydrogel, which is a type of material that is made up of a network of cross-linked polymer chains and is able to hold large amounts of water. As the natural extracellular matrix (ECM) is important in the survival, proliferation, differentiation and migration of the cells, hydrogels mimicking natural ECM structure are considered as potential approaches towards in vivo –like cell culturing.
Sources: en.wikipedia.org
Common methods include enzymatic recycling assays, liquid chromatography, and mass spectrometry. Many protocols separate reduced glutathione from its oxidized disulfide form before detection.
The ratio compares reduced glutathione with its oxidized dimer. It is used as an indicator of redox status, although the value depends strongly on sample handling and analytical method.
Glutathione can oxidize quickly after a sample is collected. Acidification, cooling, and chelators are often used to reduce artifactual changes before analysis.
It is a tripeptide of glutamic acid, cysteine, and glycine. The linkage between glutamate and cysteine uses the gamma-carboxyl group, which is unusual for peptides.